PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0232.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YC
Protein Properties Length: 267aa    MW: 29011.1 Da    PI: 4.7979
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0232.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC50.73.8e-166802498
                NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                         arikki++adedv +i+  +Pvl+ska elf+ +l   ++  + ++  +t+    ++ +v+r  ifdfl ++v +
  Kaladp0060s0232.2.p  6 ARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDMTYGITVQTGAKTVSSLHLKHCVQRYSIFDFLKEVVNK 80
                         8*********************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.0E-16565IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.9E-22679IPR009072Histone-fold
SuperFamilySSF471132.29E-181282IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MIVFQARIKK IMQADEDVGK IALAVPVLVS KALELFLQDL CDMTYGITVQ TGAKTVSSLH  60
LKHCVQRYSI FDFLKEVVNK VPDYTHSGTS GEVQTISRRR KGAGDELSDS DEYSKRSRLQ  120
EAVPGVGGGR GRGRGRGRGR GRGRVGHVAE PDDAQNDFEP ESSAVNLDAI QANNNNKGRE  180
LPSDFKGDGD GLTNPVVGKF DLNTEIKEKE STPSLATDDK VSAHSAIQSE NAELGISEMD  240
RMNFNPLQLG SMKSTFDDDE DYDDDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-166661575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133142RGRGRGRGRG
2133143RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471322.11e-65PREDICTED: dr1-associated corepressor
TrEMBLV4SXS02e-65V4SXS0_9R
STRINGVIT_13s0084g00040.t011e-58(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.14e-55nuclear factor Y, subunit C11